PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01679.70
Common NameJCGZ_11556, LOC105640751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family MYB
Protein Properties Length: 343aa    MW: 38445 Da    PI: 6.0489
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01679.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +v ++G+g+W++ +++ g++R++k+c++rw +yl
    Jcr4S01679.70 14 RGLWTAEEDAKLLAYVSKHGTGNWSALPKKAGLRRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding46.49.3e-1569110346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +T+ E+el+v++++  G++ W+ Ia+ ++ gRt++++k++w++
    Jcr4S01679.70  69 TFTPHEEELIVRLHAAIGSR-WSIIAQQLP-GRTDNDIKNYWNT 110
                      79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-24664IPR009057Homeodomain-like
PROSITE profilePS5129424.517965IPR017930Myb domain
SuperFamilySSF466891.06E-3011108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
CDDcd001673.25E-121761No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2465116IPR009057Homeodomain-like
SMARTSM007172.1E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129417.67766116IPR017930Myb domain
CDDcd001676.54E-1069112No hitNo description
PfamPF002491.0E-1269110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRPPCFDEL NVRRGLWTAE EDAKLLAYVS KHGTGNWSAL PKKAGLRRCG KSCRLRWTNY  60
LRPDLKHDTF TPHEEELIVR LHAAIGSRWS IIAQQLPGRT DNDIKNYWNT KLRKKLSEMG  120
IDPVTHKPFS QIIADYGNIG CLPRYGNRIS SLTRDLKNAF ISKPAEGLTI SNPNNYNTHH  180
LVPPKMESIQ ECFLNNGASC NQSLDLLDQL QAIKLVTEAT NFLRDQGSLS SSASSSCSNS  240
SSSTCSTAGQ EKSALSFSWR DFLLDDAFIS NDNHNYQVQE QENFMELSSK GDFTGQIRKM  300
DMAIPTPGTG HQDPSSCSDA SFLEAMLDQE NEDFLDFPNL LEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27141167108B-MYB
1mse_C6e-27141164105C-Myb DNA-Binding Domain
1msf_C6e-27141164105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0347310.0KM034731.1 Jatropha curcas clone JcMYB111 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080536.10.0PREDICTED: myb-related protein Hv1
TrEMBLA0A067KFZ90.0A0A067KFZ9_JATCU; MYB family protein
STRINGPOPTR_0015s07900.11e-137(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.12e-72MYB family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]